PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_007495-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 308aa    MW: 35152.3 Da    PI: 10.2102
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_007495-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.61.6e-092975347
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                     +WT eE +++ da + + ++   +W ++a++++ g+t +++   ++ +
    NNU_007495-RA 29 AWTHEENKRFEDALAVYDKDtpdRWMKVAAMIP-GKTVEDVMRQYNEL 75
                     7********************************.*********99987 PP

2Myb_DNA-binding42.51.5e-13136180347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +W+++E+ l++ + k++G+g+W+ I+r++  +Rt+ q+ s+ qky
    NNU_007495-RA 136 PWSEDEHRLFLLGLKRYGKGDWRNISRKFVVTRTPTQVASHAQKY 180
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.5E-52476IPR009057Homeodomain-like
SuperFamilySSF466894.71E-122578IPR009057Homeodomain-like
PROSITE profilePS512938.9372580IPR017884SANT domain
SMARTSM007178.4E-92678IPR001005SANT/Myb domain
PfamPF002491.4E-72976IPR001005SANT/Myb domain
CDDcd001671.10E-72976No hitNo description
Gene3DG3DSA:1.10.10.607.2E-11127185IPR009057Homeodomain-like
PROSITE profilePS5129419.589129185IPR017930Myb domain
SuperFamilySSF466891.08E-15131184IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-17132184IPR006447Myb domain, plants
SMARTSM007171.0E-11133183IPR001005SANT/Myb domain
PfamPF002493.2E-11136180IPR001005SANT/Myb domain
CDDcd001673.03E-10136181No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MRSGMEILSP ASYHHTNSNW FLHERKSRAW THEENKRFED ALAVYDKDTP DRWMKVAAMI  60
PGKTVEDVMR QYNELLVDVG HIEAGRIPIP GYRTPSFTLD WTNNRGFDGF KQSFSPGGRR  120
ATSGRPSDQE RKKGVPWSED EHRLFLLGLK RYGKGDWRNI SRKFVVTRTP TQVASHAQKY  180
FIRQLSGGKD KRRSSIHDIT TVNITDTRPP SPDNDRAPSP DHSIVLPQQS NLAVTPKVQF  240
DWSQPNNGPA MVFNQTNGNM FMSPSSGVAS YGHKLQGQHQ PREASYGYHF GPQHSIFQMQ  300
SSQYHQIA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A7e-202894975RADIALIS
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010256655.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-124DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A061GWE31e-148A0A061GWE3_THECC; DIV1A protein
STRINGVIT_06s0004g06100.t011e-147(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.11e-101Homeodomain-like transcriptional regulator